Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TMPRSS2. Target Synonyms: Serine protease 10. Accession Number: O15393. Expression Region: 106~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein.

Accession Number

O15393

Expression Region

106~492aa

Host

E. coli

Target

TMPRSS2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Biochemicals

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Serine protease 10

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IGF binding protein 6 Recombinant Protein C-6 His Tag Lyophilized
MBS8434136-01 0.05 mg

Mouse IGF binding protein 6 Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
Mouse IGF binding protein 6 Recombinant Protein C-6 His Tag Lyophilized
MBS8434136-02 5x 0.05 mg

Mouse IGF binding protein 6 Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
Transglutaminase-1 Rabbit Polyclonal Antibody (APC-Cy7)
orb1575651 100 µL

Transglutaminase-1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
TREM2 agonist-1
MBS5805185 Inquire

TREM2 agonist-1

Sign In for Pricing
View Details
C3 Knockout SK-HEP-1 Polyclonal Cells
ARG41446 1 Million

C3 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
2-Bromo-4,5-difluorobenzyl fluoride
PC502905-01 250 mg

2-Bromo-4,5-difluorobenzyl fluoride

Sign In for Pricing
View Details