Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSCD4 Rabbit Polyclonal Antibody (FITC)

PSCD4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CYT4, PSCD4, DJ63G5.1, cytohesin-4

UniProt

Q9UIA0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSCD4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990M-01 50 Tests

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990M-02 100 Tests

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
BC2059 10mg
A14381-10 10 mg

BC2059 10mg

Sign In for Pricing
View Details
Usp12 Peptide - N-terminal region
orb2006018 100 µg

Usp12 Peptide - N-terminal region

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus Elongation factor 2 (fusA), partial
MBS1149305 Inquire

Recombinant Sulfolobus islandicus Elongation factor 2 (fusA), partial

Sign In for Pricing
View Details