Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp12 Peptide - N-terminal region

Usp12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ubh1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Usp12 Rabbit Polyclonal Antibody (orb582902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q9D9M2

Preservative

Lyophilized powder

AA Sequence

HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM22 Conjugated Antibody
C40381 100 µL

TRIM22 Conjugated Antibody

Sign In for Pricing
View Details
FFPE Tissue Blocks, Breast
CB802222 1 Block

FFPE Tissue Blocks, Breast

Sign In for Pricing
View Details
TGX 221 10 mg
5832/10 10 mg

TGX 221 10 mg

Sign In for Pricing
View Details
Cyyr1 (NM_001013980) Rat Tagged Lenti ORF Clone
RR210915L3 10 µg

Cyyr1 (NM_001013980) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dipeptidyl Peptidase 10 (DPP10) Antibody
abx122093-01 100 µg

Dipeptidyl Peptidase 10 (DPP10) Antibody

Sign In for Pricing
View Details
Dipeptidyl Peptidase 10 (DPP10) Antibody
abx122093-02 1 mg

Dipeptidyl Peptidase 10 (DPP10) Antibody

Sign In for Pricing
View Details