Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL2 Rabbit Polyclonal Antibody (FITC)

PPIL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CYC4, CYP60, UBOX7, Cyp-60, hCyP-60

UniProt

Q13356

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat B7-1/CD80 ELISA Kit PicoKine®
EK0709 96 Well With Removable Strips

Rat B7-1/CD80 ELISA Kit PicoKine®

Sign In for Pricing
View Details
Egln3 Antibody Pair
MBS7042007-01 1 Pair (Sufficient for 5x96 well plates)

Egln3 Antibody Pair

Sign In for Pricing
View Details
Egln3 Antibody Pair
MBS7042007-02 5x 1 Pair (Sufficient for 25x 96 Well Plates)

Egln3 Antibody Pair

Sign In for Pricing
View Details
NFATC1 (Nuclear factor of activated T-cells, cytoplasmic 1) BioAssayTM ELISA Kit (Human) discontinued
357589-01 48 Tests

NFATC1 (Nuclear factor of activated T-cells, cytoplasmic 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
NFATC1 (Nuclear factor of activated T-cells, cytoplasmic 1) BioAssayTM ELISA Kit (Human) discontinued
357589-02 96 Tests

NFATC1 (Nuclear factor of activated T-cells, cytoplasmic 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
RAB3B, CT (RAB3B, Ras-related protein Rab-3B) (MaxLight 490) discontinued
040764-ML490 100 µL

RAB3B, CT (RAB3B, Ras-related protein Rab-3B) (MaxLight 490) discontinued

Sign In for Pricing
View Details