Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDHD2 Rabbit Polyclonal Antibody (FITC)

DDHD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPG54, SAMWD1, iPLA1gamma, iPLA (1) gamma

UniProt

O94830

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDHD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B) (FITC)
MBS6488337-01 0.2 mL

MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B) (FITC)

Sign In for Pricing
View Details
MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B) (FITC)
MBS6488337-02 5x 0.2 mL

MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B) (FITC)

Sign In for Pricing
View Details
INADL Peptide - N-terminal region
orb1997471 100 µg

INADL Peptide - N-terminal region

Sign In for Pricing
View Details
Rno-miR-29c-5p miRNA Agomir
orb1916868-01 5 nmol

Rno-miR-29c-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-29c-5p miRNA Agomir
orb1916868-02 10 nmol

Rno-miR-29c-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-29c-5p miRNA Agomir
orb1916868-03 20 nmol

Rno-miR-29c-5p miRNA Agomir

Sign In for Pricing
View Details