INADL Peptide - N-terminal region
INADL Peptide - N-terminal region
Product Specifications
Product Name Alternative
Cipp, INADL, hINADL, InaD-like
UniProt
Q8NI35
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INADL Rabbit Polyclonal Antibody (orb635619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_795352
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-100 1x 100 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940040-100 1x 100 µL
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680495-100 1x 100 µL
SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401783-100 1x 100 µL
CD45RB (B-Cell Marker) (PTPRC/1783R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details