Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTK1 Rabbit Polyclonal Antibody (HRP)

GSTK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GST, GST13, hGSTK1, GSTK1-1, GST13-13, GST 13-13

UniProt

Q9Y2Q3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GSTK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_057001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dip2b (NM_172819) Mouse Tagged Lenti ORF Clone
MR217496L4 10 µg

Dip2b (NM_172819) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein
PH36559M5 20 µg

Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human TIMM13 Protein
E30P12592 20 µg

Recombinant Human TIMM13 Protein

Sign In for Pricing
View Details
Human DMRTC1 shRNA Plasmid
abx961878-01 150 µg

Human DMRTC1 shRNA Plasmid

Sign In for Pricing
View Details
Human DMRTC1 shRNA Plasmid
abx961878-02 300 µg

Human DMRTC1 shRNA Plasmid

Sign In for Pricing
View Details
Nori® Human 2-Plex ELISA Kits-cTnT/CRP
GR230068 96 Well

Nori® Human 2-Plex ELISA Kits-cTnT/CRP

Sign In for Pricing
View Details