Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf67 Rabbit Polyclonal Antibody (HRP)

C11orf67 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CK067, PTD015, C11orf67

UniProt

Q9H7C9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C11orf67

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078960

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Procyanidin B-5 3,3'-di-O-gallate
HY-N9777-01 1 mg

Procyanidin B-5 3,3'-di-O-gallate

Sign In for Pricing
View Details
Procyanidin B-5 3,3'-di-O-gallate
HY-N9777-02 5 mg

Procyanidin B-5 3,3'-di-O-gallate

Sign In for Pricing
View Details
Goat Aldehyde oxidase (AOX1) ELISA Kit
GTR10363174 96 Well

Goat Aldehyde oxidase (AOX1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse LY-96/ ESOP-1 Protein, His-SUMO, E.coli-500ug
QP6327-ec-500ug 500ug

Recombinant Mouse LY-96/ ESOP-1 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
F/F017/NL499/PP-450X150-1 Fire & Disaster Signs (No Adhesive)
309444 1 Pack (1 Panel (s) x 1 Pack)

F/F017/NL499/PP-450X150-1 Fire & Disaster Signs (No Adhesive)

Sign In for Pricing
View Details
IL10 Rabbit Monoclonal Antibody
TA422963 100 µL

IL10 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details