Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EHD4 Rabbit Polyclonal Antibody (HRP)

EHD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAST4

UniProt

Q9H223

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EHD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_644670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP35 Protein Vector (Human) (pPB-C-His)
PV059617 500 ng

USP35 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Hspbp1 Peptide - C-terminal region
orb2006335 100 µg

Hspbp1 Peptide - C-terminal region

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)
MBS2104457-01 5x 96 Tests

Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)
MBS2104457-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)
MBS2104457-03 10x 96 Tests

Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)
MBS2104457-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Serine/Threonine Kinase 39 (STK39) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details