Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspbp1 Peptide - C-terminal region

Hspbp1 Peptide - C-terminal region

Product Specifications

UniProt

Q6IMX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspbp1 Rabbit Polyclonal Antibody (orb582527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640354

Preservative

Lyophilized powder

AA Sequence

VLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CAT Antibody
RC-6965-01 50 μL

Recombinant CAT Antibody

Sign In for Pricing
View Details
Recombinant CAT Antibody
RC-6965-02 100 µL

Recombinant CAT Antibody

Sign In for Pricing
View Details
Recombinant CAT Antibody
RC-6965-03 1 mL

Recombinant CAT Antibody

Sign In for Pricing
View Details
DTX2 Antibody
KC-2613-01 50 μL

DTX2 Antibody

Sign In for Pricing
View Details
DTX2 Antibody
KC-2613-02 100 µL

DTX2 Antibody

Sign In for Pricing
View Details
DTX2 Antibody
KC-2613-03 1 mL

DTX2 Antibody

Sign In for Pricing
View Details