Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam123a Rabbit Polyclonal Antibody (HRP)

Fam123a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ame, Fam12, Fam123a, 2600011E07Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSHCECAAETPAAEPPSGKINKAAFKLFKKRKSGGTMPSIFGVKNKGDGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glut1 Alexa Fluor 594 Antibody (Clone 202915)
FAB1418T-100UG 100 µg

Human Glut1 Alexa Fluor 594 Antibody (Clone 202915)

Sign In for Pricing
View Details
Lentiviral mouse Vmn2r32 shRNA (UAS) - Lentiviral mouse Vmn2r32 shRNA (UAS, RFP) plasmid
GTR15247369 1 Vial

Lentiviral mouse Vmn2r32 shRNA (UAS) - Lentiviral mouse Vmn2r32 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ASAH1 Antibody, HRP conjugated
A55191-50UG 50 µg

ASAH1 Antibody, HRP conjugated

Sign In for Pricing
View Details
HTR2B Rabbit pAb (APR25998N)
APR25998N-01 50 µL

HTR2B Rabbit pAb (APR25998N)

Sign In for Pricing
View Details
HTR2B Rabbit pAb (APR25998N)
APR25998N-02 100 µL

HTR2B Rabbit pAb (APR25998N)

Sign In for Pricing
View Details
HTR2B Rabbit pAb (APR25998N)
APR25998N-03 200 µL

HTR2B Rabbit pAb (APR25998N)

Sign In for Pricing
View Details