Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR2B Rabbit pAb (APR25998N)

Product Specifications

Background

This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HTR2B Rabbit pAb (APR25998N) .

Synonyms

HTR2B; 5-HT (2B) ; 5-HT-2B; 5-HT2B

Gene ID

3357

UniProt

P41595

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, synapse, synaptosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 54kDa Observed MW: 47KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3357

Uniprot URL

https://www.uniprot.org/uniprot/P41595

AA Sequence

LFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

B7-2 (CD86) Human Recombinant Protein
TP724009 100 µg

B7-2 (CD86) Human Recombinant Protein

Ask
View Details
FAM20C Human qPCR Template Standard (NM_020223)
HK202959 1 Kit

FAM20C Human qPCR Template Standard (NM_020223)

Ask
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]
MBS4382034-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]

Ask
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]
MBS4382034-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]

Ask
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]
MBS4382034-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]

Ask
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]
MBS4382034-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) Recombinant Mouse Monoclonal Antibody [Clone rKRT5/6398]

Ask
View Details