Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGC51025 Rabbit Polyclonal Antibody (Biotin)

MGC51025 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q86UD7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MGC51025

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_848666

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP2, ID (WNT1-inducible-signaling Pathway Protein 2, WISP-2, Connective Tissue Growth Factor-like Protein, CTGF-L, Connective Tissue Growth Factor-related Protein 58, CCN Family Member 5, CCN5, CT58, CTGFL, UNQ228/PRO261) (Biotin)
MBS6506017-01 0.2 mL

WISP2, ID (WNT1-inducible-signaling Pathway Protein 2, WISP-2, Connective Tissue Growth Factor-like Protein, CTGF-L, Connective Tissue Growth Factor-related Protein 58, CCN Family Member 5, CCN5, CT58, CTGFL, UNQ228/PRO261) (Biotin)

Sign In for Pricing
View Details
WISP2, ID (WNT1-inducible-signaling Pathway Protein 2, WISP-2, Connective Tissue Growth Factor-like Protein, CTGF-L, Connective Tissue Growth Factor-related Protein 58, CCN Family Member 5, CCN5, CT58, CTGFL, UNQ228/PRO261) (Biotin)
MBS6506017-02 5x 0.2 mL

WISP2, ID (WNT1-inducible-signaling Pathway Protein 2, WISP-2, Connective Tissue Growth Factor-like Protein, CTGF-L, Connective Tissue Growth Factor-related Protein 58, CCN Family Member 5, CCN5, CT58, CTGFL, UNQ228/PRO261) (Biotin)

Sign In for Pricing
View Details
Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial
CSB-EP747471MO-01 10 µg

Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial

Sign In for Pricing
View Details
Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial
CSB-EP747471MO-02 50 µg

Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial

Sign In for Pricing
View Details
Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial
CSB-EP747471MO-03 200 µg

Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial

Sign In for Pricing
View Details
Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial
CSB-EP747471MO-04 500 µg

Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial

Sign In for Pricing
View Details