Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NAD (+) hydrolase SARM1 (Sarm1), partial

Product Specifications

Product Name Alternative

(NADase SARM1) (Sterile alpha and TIR motif-containing protein 1)

Abbreviation

Recombinant Mouse Sarm1 protein, partial

Gene Name

Sarm1

UniProt

Q6PDS3

Expression Region

409-705aa

Organism

Mus musculus (Mouse)

Target Sequence

VASWKEAEVQTWLQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILSAAREMLHSPLPCTGGKLSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRPSQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

NAD (+) hydrolase, which plays a key role in axonal degeneration following injury by regulating NAD (+) metabolism. Acts as a negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway by promoting Wallerian degeneration, an injury-induced form of programmed subcellular death which involves degeneration of an axon distal to the injury site. Wallerian degeneration is triggered by NAD (+) depletion: in response to injury, SARM1 is activated and catalyzes cleavage of NAD (+) into ADP-D-ribose (ADPR), cyclic ADPR (cADPR) and nicotinamide; NAD (+) cleavage promoting cytoskeletal degradation and axon destruction. Also able to hydrolyze NADP (+), but not other NAD (+) -related molecules. Can activate neuronal cell death in response to stress. Regulates dendritic arborization through the MAPK4-JNK pathway. Involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.7 kDa

References & Citations

"Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934839/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse AP3S2 siRNA
abx907738-01 15 nmol

Mouse AP3S2 siRNA

Ask
View Details
Mouse AP3S2 siRNA
abx907738-02 30 nmol

Mouse AP3S2 siRNA

Ask
View Details
PathScan® RP ApoE4 Sandwich ELISA Kit
CST 76145V4 50 Kits

PathScan® RP ApoE4 Sandwich ELISA Kit

Ask
View Details
Anti-ApoF Rabbit Monoclonal Antibody
MA1276-.1 100 µL

Anti-ApoF Rabbit Monoclonal Antibody

Ask
View Details
Human Twinfilin 1 (TWF1) Protein
abx069579-01 1 mg

Human Twinfilin 1 (TWF1) Protein

Ask
View Details
Human Twinfilin 1 (TWF1) Protein
abx069579-02 5 mg

Human Twinfilin 1 (TWF1) Protein

Ask
View Details