Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS7 Rabbit Polyclonal Antibody (HRP)

SFRS7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

9G8, AAG3, SFRS7

UniProt

Q16629

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001026854

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Daxx(Phospho Ser668) Polyclonal Antibody
JOT-AP05864-01 20 µL

Daxx(Phospho Ser668) Polyclonal Antibody

Sign In for Pricing
View Details
Daxx(Phospho Ser668) Polyclonal Antibody
JOT-AP05864-02 50 μL

Daxx(Phospho Ser668) Polyclonal Antibody

Sign In for Pricing
View Details
Daxx(Phospho Ser668) Polyclonal Antibody
JOT-AP05864-03 100 µL

Daxx(Phospho Ser668) Polyclonal Antibody

Sign In for Pricing
View Details
TNNT3 (Troponin T, Fast Skeletal Muscle, TnTf, Beta-TnTF, Fast Skeletal Muscle Troponin T, fTnT) (PE)
134581-PE 100 µL

TNNT3 (Troponin T, Fast Skeletal Muscle, TnTf, Beta-TnTF, Fast Skeletal Muscle Troponin T, fTnT) (PE)

Sign In for Pricing
View Details
VGLL4 Human Pre-designed siRNA Set A
HY-RS15647 1 Set

VGLL4 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Axin 2 Rabbit Polyclonal Antibody
APRab00181-01 20 µL

Axin 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details