Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Twf1 Rabbit Polyclonal Antibody (Biotin)

Twf1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ptk9

UniProt

Q5RJR2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Porcine Epidemic Diarrhea Virus Monoclonal Antibody
VD11Y503 1 Each

Mouse Anti-Porcine Epidemic Diarrhea Virus Monoclonal Antibody

Sign In for Pricing
View Details
TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 550)
MBS6503856-01 0.1 mL

TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 550)

Sign In for Pricing
View Details
TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 550)
MBS6503856-02 5x 0.1 mL

TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 550)

Sign In for Pricing
View Details
CD62L (SELL) Human Over-expression Lysate
orb1341845 100 µg

CD62L (SELL) Human Over-expression Lysate

Sign In for Pricing
View Details
FBXO31 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb891972 100 µL

FBXO31 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
ZNF362 Peptide - N-terminal region
orb2004277 100 µg

ZNF362 Peptide - N-terminal region

Sign In for Pricing
View Details