ZNF362 Peptide - N-terminal region
ZNF362 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RN, lin-29
UniProt
Q5T0B9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF362 Rabbit Polyclonal Antibody (orb581216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689706
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BCL2 Mouse Monoclonal Antibody [Clone ID: OTI3B8]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f15/imageurl/cf806623.webp)
BNC043286-100 1x 100 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details