Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RP2 Rabbit Polyclonal Antibody (HRP)

RP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

XRP2, NME10, TBCCD2, NM23-H10, DELXp11.3

UniProt

O75695

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_008846

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9)
orb2914759-01 20 µg

Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9)

Sign In for Pricing
View Details
Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9)
orb2914759-02 100 µg

Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9)

Sign In for Pricing
View Details
Uric Acid Reagent Folin/Newton
281400100 100 mL

Uric Acid Reagent Folin/Newton

Sign In for Pricing
View Details
ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-Binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1) (APC)
207492-APC 100 µL

ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-Binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1) (APC)

Sign In for Pricing
View Details
SMPD4 Rabbit Polyclonal Antibody (HRP)
orb474074 100 µL

SMPD4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-Human Actin, Muscle Specific (ABT024) Mouse Monoclonal Antibody (Ready to Use)
MBS9511466-01 3 mL (RTU)

Anti-Human Actin, Muscle Specific (ABT024) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details