Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9)

This Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Palmitoyltransferase ZDHHC9, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 9, DHHC-9, DHHC9

UniProt

Q5R5J8

Expression Region

1-364

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL AVQQSPAIPVFAAMLFLFSMATLLRASFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ RPPPRIKNSQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPDDSSTPEEMPPPEPPEPPQEAA EAEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF740 conjugate, 0.1mg/mL
BNC740698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF740 conjugate, 0.1mg/mL
BNC742039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF647 conjugate, 0.1mg/mL
BNC470631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details