Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nap1l2 Rabbit Polyclonal Antibody (HRP)

Nap1l2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bp, Bpx

UniProt

P51860

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Nap1l2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk16 ORF Vector (Rat) (pORF)
ORF064765 1.0 µg DNA

Cdk16 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial
orb3155696-01 20 µg

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

Sign In for Pricing
View Details
Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial
orb3155696-02 100 µg

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

Sign In for Pricing
View Details
Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial
orb3155696-03 1 mg

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

Sign In for Pricing
View Details
Secretory Leukocyte Peptidase Inhibitor (SLPI) Magnetic Fluorescence Assay Kit
MBS2157221-01 96 Tests

Secretory Leukocyte Peptidase Inhibitor (SLPI) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Secretory Leukocyte Peptidase Inhibitor (SLPI) Magnetic Fluorescence Assay Kit
MBS2157221-02 5x 96 Tests

Secretory Leukocyte Peptidase Inhibitor (SLPI) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details