Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide

UniProt

P48756

Expression Region

22-85aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.47.

AA Sequence

EKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (PMEL/783), CF568 conjugate, 0.1mg/mL
BNC680783-500 1x 500 µL

Pmel17 / gp100 / SILV (PMEL/783), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP510822 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
BMP11 (GDF11) Human Gene Knockout Kit (CRISPR)
KN422080 1 Kit

BMP11 (GDF11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DUSP14 (NM_007026) Human Over-expression Lysate
LY402077 100 µg

DUSP14 (NM_007026) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DERPC activation kit by CRISPRa
GA120091 1 Kit

Human DERPC activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant FOXL2 Antibody
RC-15922-01 50 μL

Recombinant FOXL2 Antibody

Sign In for Pricing
View Details