Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN1 Rabbit Polyclonal Antibody (FITC)

MFN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hfzo1, hfzo2

UniProt

Q8IWA4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MFN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PERK (Thr980) Polyclonal Antibody, Biotin Conjugated
bs-3330R-Biotin-TR 20 µL

Phospho-PERK (Thr980) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CINP Mouse Monoclonal Antibody [Clone ID: OTI4E9]
CF812210 100 µg

CINP Mouse Monoclonal Antibody [Clone ID: OTI4E9]

Sign In for Pricing
View Details
SNAP29 Rabbit mAb
AB101500 100 µL

SNAP29 Rabbit mAb

Sign In for Pricing
View Details
Zinc Finger Protein 420 (ZNF420) Antibody (Biotin)
abx344904-01 50 µL

Zinc Finger Protein 420 (ZNF420) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 420 (ZNF420) Antibody (Biotin)
abx344904-02 100 µL

Zinc Finger Protein 420 (ZNF420) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 420 (ZNF420) Antibody (Biotin)
abx344904-03 200 µL

Zinc Finger Protein 420 (ZNF420) Antibody (Biotin)

Sign In for Pricing
View Details