Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk9 Rabbit Polyclonal Antibody (Biotin)

Mapk9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JNK, Prk, JNK2, Prkm9, AI851083, p54aSAPK

UniProt

Q9WTU6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058657

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR6 Recombinant Antibody, Cy5.5 Conjugated
bsm-61786R-Cy5.5 100 µL

PAR6 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
BHMT Recombinant Protein
OPCD01634-10UG 10 µg

BHMT Recombinant Protein

Sign In for Pricing
View Details
TK1 Antibody / Thymidine Kinase 1
RQ5042 100 µL

TK1 Antibody / Thymidine Kinase 1

Sign In for Pricing
View Details
Methyl a-D-glucopyranoside 2,3,4,6-tetrasulfate potassium salt
sc-286284 50 mg

Methyl a-D-glucopyranoside 2,3,4,6-tetrasulfate potassium salt

Sign In for Pricing
View Details
BSND Protein Vector (Human) (pPM-C-HA)
PV004319 500 ng

BSND Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CABC1 (ADCK3, CABC1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (MaxLight 750)
MBS6231244-01 0.1 mL

CABC1 (ADCK3, CABC1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (MaxLight 750)

Sign In for Pricing
View Details