Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Rabbit Polyclonal Antibody (FITC)

INKA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fam212b, RGD1306526

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAST2 ELISA Kit (Human) (OKCD00544)
OKCD00544 96 Well

MAST2 ELISA Kit (Human) (OKCD00544)

Sign In for Pricing
View Details
Cyclin A1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2409138 100 µL

Cyclin A1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
DPAGT1 Human Gene Knockout Kit (CRISPR)
KN401787 1 Kit

DPAGT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Xanthobacter flavus Fructose-bisphosphate aldolase (cbbA)
MBS1404425-01 0.02 mg (E-Coli)

Recombinant Xanthobacter flavus Fructose-bisphosphate aldolase (cbbA)

Sign In for Pricing
View Details
Recombinant Xanthobacter flavus Fructose-bisphosphate aldolase (cbbA)
MBS1404425-02 0.02 mg (Yeast)

Recombinant Xanthobacter flavus Fructose-bisphosphate aldolase (cbbA)

Sign In for Pricing
View Details
Recombinant Xanthobacter flavus Fructose-bisphosphate aldolase (cbbA)
MBS1404425-03 0.1 mg (E-Coli)

Recombinant Xanthobacter flavus Fructose-bisphosphate aldolase (cbbA)

Sign In for Pricing
View Details