Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Rabbit Polyclonal Antibody (HRP)

INKA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fam212b, RGD1306526

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) IRT2 Polyclonal Antibody
MBS7196948 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) IRT2 Polyclonal Antibody

Sign In for Pricing
View Details
Flurbiprofen-d3 (2-Fluoro-a-trideuteromethyl-[1,1’-biphenyl]-4-acetic Acid)
F5277-51 5 mg

Flurbiprofen-d3 (2-Fluoro-a-trideuteromethyl-[1,1’-biphenyl]-4-acetic Acid)

Sign In for Pricing
View Details
Rabbit Polyclonal Septin-10 Antibody [DyLight 755]
NBP2-44288IR 0.1 mL

Rabbit Polyclonal Septin-10 Antibody [DyLight 755]

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Alligator IgG (H+L) Secondary Antibody [PE]
NB100-55301PE 1 mL

Goat Polyclonal Goat anti-Alligator IgG (H+L) Secondary Antibody [PE]

Sign In for Pricing
View Details
CAMK2A Antibody (Phospho-Thr286)
OASG00968-100UL 100 µL

CAMK2A Antibody (Phospho-Thr286)

Sign In for Pricing
View Details
Rabbit Anti-Human ASB5 pAb
PA8065-01 50 μL

Rabbit Anti-Human ASB5 pAb

Sign In for Pricing
View Details