Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXN3 Rabbit Polyclonal Antibody (FITC)

FOXN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHES1, PRO1635, C14orf116

UniProt

O00409

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRXS11 Protein Vector (Human) (pPB-N-His)
PV101599 500 ng

MRXS11 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human Nectin-2 (NECTIN2), partial (Active)
CSB-AP005081HU-01 50 µg

Recombinant Human Nectin-2 (NECTIN2), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Nectin-2 (NECTIN2), partial (Active)
CSB-AP005081HU-02 500 µg

Recombinant Human Nectin-2 (NECTIN2), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Nectin-2 (NECTIN2), partial (Active)
CSB-AP005081HU-03 1 mg

Recombinant Human Nectin-2 (NECTIN2), partial (Active)

Sign In for Pricing
View Details
Lentiviral mouse Dimt1 shRNA (UAS) - Lentiviral mouse Dimt1 shRNA (UAS, GFP) (100)
GTR15258933 1 Vial

Lentiviral mouse Dimt1 shRNA (UAS) - Lentiviral mouse Dimt1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2, Antigen Nuclear Dot 52kD Protein, Nuclear Domain 10 Protein NDP52, Nuclear Domain 10 Protein 52, Nuclear Dot Protein 52, NDP52) (Not for Export EU)
124253 100 µL

CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2, Antigen Nuclear Dot 52kD Protein, Nuclear Domain 10 Protein NDP52, Nuclear Domain 10 Protein 52, Nuclear Dot Protein 52, NDP52) (Not for Export EU)

Sign In for Pricing
View Details