Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nectin-2 (NECTIN2), partial (Active)

Product Specifications

Product Name Alternative

Poliovirus Receptor-Related Protein 2; Herpes Virus Entry Mediator B; Herpesvirus Entry Mediator B; HveB; Nectin-2; CD112; PVRL2; HVEB; PRR2

Abbreviation

Recombinant Human NECTIN2 protein, partial (Active)

Gene Name

NECTIN2

UniProt

Q92692-2

Expression Region

32-360aa

Organism

Homo sapiens (Human)

Target Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

CD112 is a type I transmembrane glycoprotein belonging to the Immunoglobulin superfamily. It comprises one Ig-like V-type domain and two Ig-like C2-type domains in the extracellular region. The V domain is believed to mediate nectin binding to its ligands. Nectin2 is known to bind the pseudorabies virus, and herpes simplex virus2 (HSV2), involving in cell to cell spreading of these viruses. It does not bind poliovirus. As a homophilic adhesion molecule, CD112 is found concentrated in adherens junctions, and exists on neurons, endothelial cells, epithelial cells and fibroblasts. CD112 has been identified as the ligand for DNAM-1 (CD226), and the interaction of CD226/CD112 mediates cytotoxicity and cytokine secretion by T and NK cells. The costimulatory responses may be a critical component in allergic reactions and may therefore become targets for anti-allergic therapy.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.①Immobilized Human PVRIG-mFc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 3.72 ug/ml.②Immobilized Human PVRIG-Fc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 2.914 ug/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive

Molecular Weight

36.58 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform Alpha

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RORC Rabbit Polyclonal Antibody (FITC)
orb2084226 100 µL

RORC Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HIST1H2BD Antibody, HRP conjugated
MBS7045937-01 0.05 mg

HIST1H2BD Antibody, HRP conjugated

Sign In for Pricing
View Details
HIST1H2BD Antibody, HRP conjugated
MBS7045937-02 0.1 mg

HIST1H2BD Antibody, HRP conjugated

Sign In for Pricing
View Details
HIST1H2BD Antibody, HRP conjugated
MBS7045937-03 5x 0.1 mg

HIST1H2BD Antibody, HRP conjugated

Sign In for Pricing
View Details
DCTN6, ID (DCTN6, WS3, Dynactin subunit 6, Dynactin subunit p27, Protein WS-3) (Azide free) (HRP)
MBS6291237-01 0.2 mL

DCTN6, ID (DCTN6, WS3, Dynactin subunit 6, Dynactin subunit p27, Protein WS-3) (Azide free) (HRP)

Sign In for Pricing
View Details
DCTN6, ID (DCTN6, WS3, Dynactin subunit 6, Dynactin subunit p27, Protein WS-3) (Azide free) (HRP)
MBS6291237-02 5x 0.2 mL

DCTN6, ID (DCTN6, WS3, Dynactin subunit 6, Dynactin subunit p27, Protein WS-3) (Azide free) (HRP)

Sign In for Pricing
View Details