Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RB1 Rabbit Polyclonal Antibody (HRP)

RB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1

UniProt

P06400

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse FOLR1 Protein (aa 25-232, His Tag)
PKSM041337-01 10 µg

Recombinant Mouse FOLR1 Protein (aa 25-232, His Tag)

Sign In for Pricing
View Details
Recombinant Mouse FOLR1 Protein (aa 25-232, His Tag)
PKSM041337-02 50 µg

Recombinant Mouse FOLR1 Protein (aa 25-232, His Tag)

Sign In for Pricing
View Details
Kallikrein 1 Antibody
RQ4114 100 µg

Kallikrein 1 Antibody

Sign In for Pricing
View Details
Anti-PNP Antibody Picoband®, Dylight594 Conjugate
A00988-2-Dylight594 100 µg

Anti-PNP Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
CHRNA2 Antibody
CSB-PA621886ESR2HU-01 50 μL

CHRNA2 Antibody

Sign In for Pricing
View Details
CHRNA2 Antibody
CSB-PA621886ESR2HU-02 100 µL

CHRNA2 Antibody

Sign In for Pricing
View Details