Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A4A Rabbit Polyclonal Antibody (HRP)

MS4A4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MS4A4, MS4A7, 4SPAN1, CD20L1, CD20-L1, HDCME31P

UniProt

Q96JQ5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_683876

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2B Recombinant Protein
OPCA02103-100UG 100 µg

Histone H2B Recombinant Protein

Sign In for Pricing
View Details
Sonepcizumab (Anti-Sphingosine-1-phosphate)
C00161-1mg*25 25x 1mg

Sonepcizumab (Anti-Sphingosine-1-phosphate)

Sign In for Pricing
View Details
TOX2, ID (TOX2, C20orf100, GCX1, TOX high mobility group box family member 2, Granulosa cell HMG box protein 1) (MaxLight 650)
MBS6357469-01 0.1 mL

TOX2, ID (TOX2, C20orf100, GCX1, TOX high mobility group box family member 2, Granulosa cell HMG box protein 1) (MaxLight 650)

Sign In for Pricing
View Details
TOX2, ID (TOX2, C20orf100, GCX1, TOX high mobility group box family member 2, Granulosa cell HMG box protein 1) (MaxLight 650)
MBS6357469-02 5x 0.1 mL

TOX2, ID (TOX2, C20orf100, GCX1, TOX high mobility group box family member 2, Granulosa cell HMG box protein 1) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) rpl4301 Polyclonal Antibody
MBS9010988 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) rpl4301 Polyclonal Antibody

Sign In for Pricing
View Details
DMT-T
5-02236 25 g

DMT-T

Sign In for Pricing
View Details