Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Histone H2B

Reactivity

Cairina moschata

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.3 kDa

Protein Length

Recombinant

Host or Source

Crocodylus niloticus

Protein Name

Histone H2B

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody
APRab04273-01 20 µL

ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody
APRab04273-02 50 µL

ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody
APRab04273-03 100 µL

ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody
APRab04273-04 200 µL

ATF-2 (phospho Ser112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSF1 Rabbit Polyclonal Antibody (Biotin)
orb2593785 100 µg

HSF1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human DYRK4 siRNA
abx914834-01 15 nmol

Human DYRK4 siRNA

Sign In for Pricing
View Details