Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACRBP Rabbit Polyclonal Antibody (FITC)

ACRBP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT23, SP32, OY-TES-1

UniProt

Q8NEB7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACRBP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish GLULa/b Rabbit Polyclonal Antibody (Fluoro488)
orb3089806 100 µg

Zebrafish GLULa/b Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
SLC7A6OS Peptide - middle region
orb1997975 100 µg

SLC7A6OS Peptide - middle region

Sign In for Pricing
View Details
Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit
MBS9919768-01 48 Well

Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit

Sign In for Pricing
View Details
Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit
MBS9919768-02 96 Well

Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit

Sign In for Pricing
View Details
Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit
MBS9919768-03 5x 96 Well

Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit

Sign In for Pricing
View Details
Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit
MBS9919768-04 10x 96 Well

Porcine Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit

Sign In for Pricing
View Details