Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A6OS Peptide - middle region

SLC7A6OS Peptide - middle region

Product Specifications

Product Name Alternative

2010007L18Rik, 2400002F02Rik

UniProt

Q7TPE5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001007568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WIENIMSVQPYSQEWELVNDDEQSEDIYEDEDDENSENNWRNEYPDEESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL
BNC880759-100 1x 100 µL

Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDX6 (NM_004397) Human Over-expression Lysate
LC401399 20 µg

DDX6 (NM_004397) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS500499 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
UPK3A Polyclonal Antibody
E-AB-18512-01 20 µL

UPK3A Polyclonal Antibody

Sign In for Pricing
View Details
UPK3A Polyclonal Antibody
E-AB-18512-02 60 µL

UPK3A Polyclonal Antibody

Sign In for Pricing
View Details
UPK3A Polyclonal Antibody
E-AB-18512-03 120 µL

UPK3A Polyclonal Antibody

Sign In for Pricing
View Details