Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stmn1 Rabbit Polyclonal Antibody (FITC)

Stmn1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, S, p, La, PP, PR, op, p1, 19k, Lag, P18, P19, Pig, Smn, Op18, Pp17, Pp18, Pp19, Pr22, Lap18, metab

UniProt

P54227

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)
orb2917573-01 20 µg

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)
orb2917573-02 100 µg

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)

Sign In for Pricing
View Details
Epithelial Marker Antigen Antibody / MUC1 / Mucin-1
orb385658-01 20 µg

Epithelial Marker Antigen Antibody / MUC1 / Mucin-1

Sign In for Pricing
View Details
Epithelial Marker Antigen Antibody / MUC1 / Mucin-1
orb385658-02 100 µg

Epithelial Marker Antigen Antibody / MUC1 / Mucin-1

Sign In for Pricing
View Details
Reagecon pH Electrode Storage Solution
ESS001 100 mL

Reagecon pH Electrode Storage Solution

Sign In for Pricing
View Details
CSP Rabbit pAb, AP conjugated
orb2824629 100 µL

CSP Rabbit pAb, AP conjugated

Sign In for Pricing
View Details