Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Uncharacterized protein Cj0236c

UniProt

Q9PIQ8

Expression Region

1-231

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLYDRDYSRSKEFENTRSSELSIFIKQTYQLFAASLLAATVGAYVGIFALASFFIQSQV TFWILFAVEIGLLFALQWKKREAPLNLVLLFGFTFCSGLTLTPLLISVLALPAGGIIIAQ AFALTTVAFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLLNLFFQSSIVNLAISAVA AILFSFYILYDTQNIIRGNYETPIEGAVALYLDFVNLFVSLLNILRSFNSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA6 (NM_001926) Human Over-expression Lysate
LC419661 20 µg

DEFA6 (NM_001926) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Isopropylnaphthalene
TRC-I872690-500MG 500 mg

2-Isopropylnaphthalene

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), Biotin conjugate, 0.1mg/mL
BNCB0195-100 1x 100 µL

CD66 (CEA) (C66/195), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMS2 (UBE2V2) Rabbit Polyclonal Antibody
TA365468 100 µL

MMS2 (UBE2V2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Flufenoxuron-d3 (2,6-Difluorobenzoyl-d3)
TRC-F435101-2.5MG 2.5 mg

Flufenoxuron-d3 (2,6-Difluorobenzoyl-d3)

Sign In for Pricing
View Details
(S)-(+)-4-Benzylmorpholin-5-one-3-carboxylic Acid
TRC-B285765-500MG 500 mg

(S)-(+)-4-Benzylmorpholin-5-one-3-carboxylic Acid

Sign In for Pricing
View Details