Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED10 Rabbit Polyclonal Antibody (FITC)

TMED10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P23, TMP21, p24d1, S31I125, Tmp-21-I, S31III125, P24 (DELTA)

UniProt

P49755

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMED10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S100P Antibody (rS100P/9254) [Janelia Fluor 549]
NBP3-24096JF549 0.1 mL

Mouse Monoclonal S100P Antibody (rS100P/9254) [Janelia Fluor 549]

Sign In for Pricing
View Details
ATXN7L3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0158505 3x 1.0 µg

ATXN7L3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant human Cellular retinoic acid-binding protein 1
OPCA00056-20UG 20 µg

Recombinant human Cellular retinoic acid-binding protein 1

Sign In for Pricing
View Details
ICAM3 Antibody
orb1252522 100 µg

ICAM3 Antibody

Sign In for Pricing
View Details
Human MACO1 Pre-designed siRNA Set A
SI009081A 1 Each

Human MACO1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-ErbB 4/ERBB4 Antibody Picoband®
PA1881 100 µg/Vial

Anti-ErbB 4/ERBB4 Antibody Picoband®

Sign In for Pricing
View Details