Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Rabbit Polyclonal Antibody (HRP)

BECN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATG6, VPS30, beclin1

UniProt

Q14457

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BECN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003757

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUF2 (NM_145697) Human Recombinant Protein
PH31652E1 50 µg

NUF2 (NM_145697) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn2r123 Mouse Gene Knockout Kit (CRISPR)
KN519138 1 Kit

Vmn2r123 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RND3 cDNA Clone
MBS1268516-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RND3 cDNA Clone

Sign In for Pricing
View Details
RND3 cDNA Clone
MBS1268516-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RND3 cDNA Clone

Sign In for Pricing
View Details
Hsa-miR-885-5p miRNA Agomir
orb1920891-01 5 nmol

Hsa-miR-885-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-885-5p miRNA Agomir
orb1920891-02 10 nmol

Hsa-miR-885-5p miRNA Agomir

Sign In for Pricing
View Details