Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC6 Rabbit Polyclonal Antibody (HRP)

PSMC6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P42, RPT5, SUG2

UniProt

P62333

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002797

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP10 siRNA (Human)
orb1863490-01 15 nmol

TCP10 siRNA (Human)

Sign In for Pricing
View Details
TCP10 siRNA (Human)
orb1863490-02 30 nmol

TCP10 siRNA (Human)

Sign In for Pricing
View Details
Scalpel Handle Graduated
0112-2 NO3

Scalpel Handle Graduated

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6)
orb2905973-01 20 µg

Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6)
orb2905973-02 100 µg

Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6)

Sign In for Pricing
View Details
ERG Human Over-expression Lysate
orb1355786 100 µg

ERG Human Over-expression Lysate

Sign In for Pricing
View Details