Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6)

This Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

G-protein coupled receptor E6

UniProt

Q66615

Expression Region

1-325

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEMRHAGQISRKLLFYFGSDNYNLSINDSMFRNCTLRADRAAALFGTMLEGVFLGIVLT MMGFFSVKTRFTPSSNIWLFAGCVAIALWLMTKMAQDYAPGPLKCIVTENLALFCSLLGG ALNVGMCVDRCRAVYSRMARGSMTPAAICTYIFWAVVGSLLVIAVNALEMSRNGLHMSEG LEGGCFQAASPLAHRAKLVAKFLMYLVFVCIVSVGTALTLVKILNTNLNRKRAICVNVVL VTLPNTFIWLTAMTSAWREFSSYKMCPKIVTGNVFIYLSSVPMLVILFVYMFTGKNLKHT LRPQTRSYSSSTGSASCFAHLAGKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD82 Recombinant Rabbit Monoclonal Antibody [JE32-17]
HA722533 100 µL

CD82 Recombinant Rabbit Monoclonal Antibody [JE32-17]

Sign In for Pricing
View Details
Human CDKL1 activation kit by CRISPRa
GA105858 1 Kit

Human CDKL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human AMID (AIFM2) activation kit by CRISPRa
GA113737 1 Kit

Human AMID (AIFM2) activation kit by CRISPRa

Sign In for Pricing
View Details
NANOG Human Gene Knockout Kit (CRISPR)
KN210243 1 Kit

NANOG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Ethyl-4-vinylbenzene (>80%)
TRC-E931988-250MG 250 mg

1-Ethyl-4-vinylbenzene (>80%)

Sign In for Pricing
View Details
Gal a(1,4)Gal b(1,4)GlcNac b-O-BSA Colloidal Gold Conjugate,  40nm
CCG-1010-40 1 mL

Gal a(1,4)Gal b(1,4)GlcNac b-O-BSA Colloidal Gold Conjugate, 40nm

Sign In for Pricing
View Details