Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POFUT1 Rabbit Polyclonal Antibody (HRP)

POFUT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DDD2, FUT12, O-FUT, OFUCT1, O-Fuc-T, O-FucT-1

UniProt

Q6EV69

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POFUT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoguanosine- 5'- O- triphosphate (isoGTP), sodium salt
I 039-05 5x 1 µmol

Isoguanosine- 5'- O- triphosphate (isoGTP), sodium salt

Sign In for Pricing
View Details
Rabbit Anti-Human PDK2 pAb
PA13595-01 50 μL

Rabbit Anti-Human PDK2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human PDK2 pAb
PA13595-02 100 μL

Rabbit Anti-Human PDK2 pAb

Sign In for Pricing
View Details
MAP2K1 Antibody
orb420229 25 µL

MAP2K1 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Complement Component C2 Antibody (014) [Alexa Fluor 532]
NBP2-89301AF532 0.1 mL

Rabbit Monoclonal Complement Component C2 Antibody (014) [Alexa Fluor 532]

Sign In for Pricing
View Details
Recombinant Human SEMA4B Protein, His Tag
32-18137-100 100 µg

Recombinant Human SEMA4B Protein, His Tag

Sign In for Pricing
View Details