Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Rabbit Polyclonal Antibody (FITC)

OPN5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PGR12, GPR136, GRP136, TMEM13

UniProt

Q6U736

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OPN5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_859528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H4/C19orf7 Polyclonal Antibody
orb1418537 100 µL

ZC3H4/C19orf7 Polyclonal Antibody

Sign In for Pricing
View Details
Pan Muscle Actin Antibody
V3100-20UG 20 µg

Pan Muscle Actin Antibody

Sign In for Pricing
View Details
1-Bromo-2- (cyclopropylsulfanyl) benzene
ZWB22914-01 50 mg

1-Bromo-2- (cyclopropylsulfanyl) benzene

Sign In for Pricing
View Details
1-Bromo-2- (cyclopropylsulfanyl) benzene
ZWB22914-02 0.5 g

1-Bromo-2- (cyclopropylsulfanyl) benzene

Sign In for Pricing
View Details
TOMM20 Polyclonal Antibody
MBS9126024-01 0.02 mL

TOMM20 Polyclonal Antibody

Sign In for Pricing
View Details
TOMM20 Polyclonal Antibody
MBS9126024-02 0.1 mL

TOMM20 Polyclonal Antibody

Sign In for Pricing
View Details