Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA11 Rabbit Polyclonal Antibody (HRP)

MAGEA11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT1.11, MAGE11, MAGE-11, MAGEA-11

UniProt

P43364

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAGEA11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STOML1 CRISPR Knock Out 293T Cell Line (Human)
45760141 1x 10^6 Cells / 1.0 mL

STOML1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Snx17 (NM_153680) Mouse Recombinant Protein
PM46172M5 20 µg

Snx17 (NM_153680) Mouse Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal DNA Polymerase epsilon subunit 3 Antibody
NBP2-92951-0.02mL 0.02 mL

Rabbit Polyclonal DNA Polymerase epsilon subunit 3 Antibody

Sign In for Pricing
View Details
Lenvatinib Impurity 101
RM-L142301-01 10 mg

Lenvatinib Impurity 101

Sign In for Pricing
View Details
Lenvatinib Impurity 101
RM-L142301-02 25 mg

Lenvatinib Impurity 101

Sign In for Pricing
View Details
Lenvatinib Impurity 101
RM-L142301-03 50 mg

Lenvatinib Impurity 101

Sign In for Pricing
View Details