Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC12 Rabbit Polyclonal Antibody (FITC)

ZDHHC12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF400, DHHC-12

UniProt

Q96GR4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZDHHC12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PUMA/BBC3 protein (His Tag)
PDEH100697-01 20 µg

Recombinant Human PUMA/BBC3 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PUMA/BBC3 protein (His Tag)
PDEH100697-02 100 µg

Recombinant Human PUMA/BBC3 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PUMA/BBC3 protein (His Tag)
PDEH100697-03 500 µg

Recombinant Human PUMA/BBC3 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PUMA/BBC3 protein (His Tag)
PDEH100697-04 1 mg

Recombinant Human PUMA/BBC3 protein (His Tag)

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF594 conjugate, 0.1mg/mL
BNC940053-500 1x 500 µL

HCG-alpha (HCGa/53), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) Mouse Monoclonal Antibody [Clone ID: AT5E10]
AM09396PU-N 100 µL

elF2 alpha (EIF2S1) Mouse Monoclonal Antibody [Clone ID: AT5E10]

Sign In for Pricing
View Details