Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP1B Rabbit Polyclonal Antibody (FITC)

CHMP1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Vps46B, C10orf2, C18orf2, CHMP1.5, Vps46-2, C18-ORF2, hVps46-2

UniProt

Q7LBR1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHMP1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A H1N1 (A/swine/England/267/2007) Hemagglutinin / HA Protein (His Tag)
E45O55155M2-100 100 µg

Influenza A H1N1 (A/swine/England/267/2007) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
Multiplex Assay Kit for Glycine (Gly), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0032069 96 Tests

Multiplex Assay Kit for Glycine (Gly), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)
orb1881919-01 20 µg

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)

Sign In for Pricing
View Details
Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)
orb1881919-02 100 µg

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)

Sign In for Pricing
View Details
Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)
orb1881919-03 1 mg

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)

Sign In for Pricing
View Details
ACOT9 Adenovirus (Human)
11194051 1.0 mL

ACOT9 Adenovirus (Human)

Sign In for Pricing
View Details