Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)

This Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3) spans the amino acid sequence from region 2-291aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BRCA1-A complex subunit BRCC36) (BRCA1/BRCA2-containing complex subunit 3) (BRCA1/BRCA2-containing complex subunit 36) (BRISC complex subunit BRCC36)

UniProt

P46737

Expression Region

2-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMEELSSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D205), CF405S conjugate, 0.1mg/mL
BNC040205-500 1x 500 µL

Complement C4d (C4D205), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant FOXL2 Antibody
RC-15922-01 50 μL

Recombinant FOXL2 Antibody

Sign In for Pricing
View Details
Recombinant FOXL2 Antibody
RC-15922-02 100 µL

Recombinant FOXL2 Antibody

Sign In for Pricing
View Details
Recombinant FOXL2 Antibody
RC-15922-03 1 mL

Recombinant FOXL2 Antibody

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127704) Human Over-expression Lysate
LY426862 100 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127704) Human Over-expression Lysate

Sign In for Pricing
View Details
Dusp9 Mouse Gene Knockout Kit (CRISPR)
KN304885 1 Kit

Dusp9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details