Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB3 Rabbit Polyclonal Antibody (HRP)

HOXB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HOX2G, Hox-2.7

UniProt

P14651

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vaspin, Human (HEK293, His)
HY-P71300-01 10 µg

Vaspin, Human (HEK293, His)

Sign In for Pricing
View Details
Vaspin, Human (HEK293, His)
HY-P71300-02 50 µg

Vaspin, Human (HEK293, His)

Sign In for Pricing
View Details
Walu Dispenser Genius 5-50ml Bottle Top Dispenser - EACH
DIS3008 1 Each

Walu Dispenser Genius 5-50ml Bottle Top Dispenser - EACH

Sign In for Pricing
View Details
Human IMPDH1 Pre-designed siRNA Set B
SI007649B 1 Each

Human IMPDH1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Acid sphingoMyelinase-Like phosphodiesterase 3b (SMPDL3B) Mouse ELISA Kit
B2145 96 Tests

Acid sphingoMyelinase-Like phosphodiesterase 3b (SMPDL3B) Mouse ELISA Kit

Sign In for Pricing
View Details
IFT52 Rabbit Polyclonal Antibody (Fluoro594)
orb3094243 100 µg

IFT52 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details