Vaspin, Human (HEK293, His)
Vaspin is an adipokine that regulates adipogenesis, metabolism, and inflammation by binding to the chemokine receptors CMKLR1 and CMKLR2. It mainly regulates adipocyte differentiation and affects lipid and glucose metabolism genes. Vaspin Protein, Human (HEK293, His) is the recombinant human-derived Vaspin protein, expressed by HEK293 , with C-10*His labeled tag.
Product Specifications
Product Name Alternative
Vaspin Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vaspin-protein-human-hek293-his.html
Purity
97.32
Smiles
LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Molecular Formula
145264 (Gene_ID) Q8IW75 (L21-K414) (Accession)
Molecular Weight
50-60 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740029-500 1x 500 µL
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940040-500 1x 500 µL
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 