Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdh1 Rabbit Polyclonal Antibody (Biotin)

Cdh1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Um, Eca, L-C, UVO, E-ca, Ecad, ARC-1, E-cad, L-CAM, E-cadh, AA960649

UniProt

P09803

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033994

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGluR6 Colorimetric Cell-Based ELISA Kit
EKC1367 1 Kit, containing one 96 Well Plate and all necessary reagents

MGluR6 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Recombinant Der p 11
A10Y49 1 Each

Recombinant Der p 11

Sign In for Pricing
View Details
Mouse Histone H3.1 ELISA Kit
MBS7279433-01 48 Well

Mouse Histone H3.1 ELISA Kit

Sign In for Pricing
View Details
Mouse Histone H3.1 ELISA Kit
MBS7279433-02 96 Well

Mouse Histone H3.1 ELISA Kit

Sign In for Pricing
View Details
Mouse Histone H3.1 ELISA Kit
MBS7279433-03 5x 96 Well

Mouse Histone H3.1 ELISA Kit

Sign In for Pricing
View Details
Mouse Histone H3.1 ELISA Kit
MBS7279433-04 10x 96 Well

Mouse Histone H3.1 ELISA Kit

Sign In for Pricing
View Details