Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS6 Rabbit Polyclonal Antibody (HRP)

GAS6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AXSF, AXLLG

UniProt

Q14393

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Human GAS6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVV

Field of Research

Cancer Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA 074
A1926-5.1 10 mM (in 1mL DMSO)

CA 074

Sign In for Pricing
View Details
C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (HRP)
MBS6371776-01 0.1 mL

C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (HRP)

Sign In for Pricing
View Details
C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (HRP)
MBS6371776-02 5x 0.1 mL

C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (HRP)

Sign In for Pricing
View Details
IHH monoclonal antibody
MB67101-01 50 µL

IHH monoclonal antibody

Sign In for Pricing
View Details
IHH monoclonal antibody
MB67101-02 100 µL

IHH monoclonal antibody

Sign In for Pricing
View Details
Rabbit anti-human Cytochrome c oxidase subunit 6B1 polyclonal Antibody
MBS715058-01 0.05 mg

Rabbit anti-human Cytochrome c oxidase subunit 6B1 polyclonal Antibody

Sign In for Pricing
View Details