Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5a Rabbit Polyclonal Antibody (HRP)

Rab5a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI663973, AU021172, nnyRab5a, 2410015H04Rik

UniProt

Q9CQD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM28 Peptide - middle region
orb1997634 100 µg

TRIM28 Peptide - middle region

Sign In for Pricing
View Details
WNK1 Protein Vector (Human) (pPB-C-His)
PV046421 500 ng

WNK1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CD69 Antibody
orb2676725-01 50 µL

CD69 Antibody

Sign In for Pricing
View Details
CD69 Antibody
orb2676725-02 100 µL

CD69 Antibody

Sign In for Pricing
View Details
CD69 Antibody
orb2676725-03 200 µL

CD69 Antibody

Sign In for Pricing
View Details
SNAI2 (snail Homolog 2 (Drosophila), MGC10182, SLUG, SLUGH1, WS2D)
251890 100 µg

SNAI2 (snail Homolog 2 (Drosophila), MGC10182, SLUG, SLUGH1, WS2D)

Sign In for Pricing
View Details