Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM28 Peptide - middle region

TRIM28 Peptide - middle region

Product Specifications

Product Name Alternative

KAP-1, Tif1b, KRIP-1, MommeD9, AA408787, Tif1beta

UniProt

Q62318

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035718.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEAFGKIVAERPGTNSTGPGPMAPPRAPGPLSKQGSGSSQPMEVQEGYGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MYOC/Myocilin Protein (His Tag)
PKSH030737 50 µg

Recombinant Human MYOC/Myocilin Protein (His Tag)

Sign In for Pricing
View Details
Triton X-100
TRC-T886800-1G 1 g

Triton X-100

Sign In for Pricing
View Details
MR1 (NM_001531) Human Over-expression Lysate
LY419881 100 µg

MR1 (NM_001531) Human Over-expression Lysate

Sign In for Pricing
View Details
1-(5-O-Acetyl-b-D-ribofuranosyl)-4-amino-1,3,5-triazin-2(1H)-one
TRC-A188035-250MG 250 mg

1-(5-O-Acetyl-b-D-ribofuranosyl)-4-amino-1,3,5-triazin-2(1H)-one

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562334 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
HOXD11 Human Gene Knockout Kit (CRISPR)
KN414985 1 Kit

HOXD11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details